Methylene blue works great, is very cheap, and it's been around for over a century. I guess I shouldn't be a hater. This seems to improve the effectiveness of existing treatments. However, shame they don't mention methylene blue though in the article.
IANAMD I made a quick search and the evidence of methylene blue as a carbon monoxide antidote looks controversial.
IIUC part of the effect is oxidizing/reducing the iron atom in the hemoglobin, and that changes how strong is the bound with the O2, CO, NO. But my chemistry is not enough to give a good guess of the results.
Reminds me how ivermectin was approached during the covid pandemic. No, it did not help against covid, but it did prevent people with strongyloidiasis receiving corticosteroids for covid from almost certain death.
Instead of ridiculing the people taking it, trying to prevent them taking it and strengthening conspiracy theories, from a public trust and health perspective, people should have been advised in how to safely take it, if they really wanted to.
From those perspective you sometimes have to work with idiots, not try to fight them. Same with the vaccinations: "hey, this vaccine might prevent you from a disease that could kill you, especially if you are fat, old and male -you SHOULD take it, but you don't have to" we got an absolutely diabolical "you will leave your job and won't be allowed to leave the house if you don't get vaccinated" laws.
"hey, speeding down the highway 35mph over the limit could kill you, especially if you are fat and old. you SHOULD drive under the speed limit, but you don't have to."
No, the point is that it could kill other people. Speed all you want when you're on your own private roads.
Laws are generally meant to ensure public safety and the ability for us to live and cooperate together with mutual trust. They usually do end up restricting your personal freedoms to that end. Deal with it.
It looks like he found a note in his room and see some strange thing in the window, and someone somehow says it's CO but it may be that the OP has unrelated hallucinations. Is this a symptom of CO poisoning? I think you only get sleepy, faint and die.
CO exposure is accumulative. If you’re around an intense source of it you’re toast. But with a small point source or decent ventilation it kills you slower.
And your body produces new blood cells every day, so minor sources like wood smoke or burning a candle don’t dose you enough to be a problem, unless perhaps your day job is as an athlete.
>New Protein Therapy Shows Promise as Antidote for Carbon Monoxide Poisoning
So Shatner was right all along: not only is Promise Margarine good for lowering your cholesterol level, but it can also treat carbon monoxide poisoning! And it tastes like butter, promise.
Here's the full sequence of the protein, found in the supplement [1]
KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRILMIKVSSMIAAGGASGTSMIFYDVTDLTTEPSGLPAGGSAPSHHHHHH
It is a protein encoding the PxRcoM-1 heme binding domain with C94S mutation and a C-terminal 6xHis tag (RcoM-HBD-C94S)
[1] https://www.pnas.org/doi/10.1073/pnas.2501389122#supplementa...
Methylene blue works great, is very cheap, and it's been around for over a century. I guess I shouldn't be a hater. This seems to improve the effectiveness of existing treatments. However, shame they don't mention methylene blue though in the article.
Hello, I would be interested if you could give evidence that methylene blue "works great" for carbon monoxide poisoning in humans.
It is not the standard of care in any guidelines I can find from any country. There is a paper from 2018 out of china showing some benefit in a rat model: https://onlinelibrary.wiley.com/doi/10.1111/bcpt.12940
IANAMD I made a quick search and the evidence of methylene blue as a carbon monoxide antidote looks controversial.
IIUC part of the effect is oxidizing/reducing the iron atom in the hemoglobin, and that changes how strong is the bound with the O2, CO, NO. But my chemistry is not enough to give a good guess of the results.
God forbid we have alternatives that work in minutes
Given that MB is commonly supported by those with right leaning politics, it won't be reported on for risk of appearing to support the "wrong" party.
Why would a treatment be not made available if it’s effective? What’s the conspiracy in letting people suffer and die?
It's been around for a century but it's a political conspiracy to keep it unknown??
Awful.
Reminds me how ivermectin was approached during the covid pandemic. No, it did not help against covid, but it did prevent people with strongyloidiasis receiving corticosteroids for covid from almost certain death.
Instead of ridiculing the people taking it, trying to prevent them taking it and strengthening conspiracy theories, from a public trust and health perspective, people should have been advised in how to safely take it, if they really wanted to.
From those perspective you sometimes have to work with idiots, not try to fight them. Same with the vaccinations: "hey, this vaccine might prevent you from a disease that could kill you, especially if you are fat, old and male -you SHOULD take it, but you don't have to" we got an absolutely diabolical "you will leave your job and won't be allowed to leave the house if you don't get vaccinated" laws.
"hey, speeding down the highway 35mph over the limit could kill you, especially if you are fat and old. you SHOULD drive under the speed limit, but you don't have to."
No, the point is that it could kill other people. Speed all you want when you're on your own private roads.
Laws are generally meant to ensure public safety and the ability for us to live and cooperate together with mutual trust. They usually do end up restricting your personal freedoms to that end. Deal with it.
health officials shouldn't have to work around the fucking president pulling conspiracies out their ass.
Methylene blue has a fun/shocking side-effect.
Turns your pee blue
Is that the one that turns your organs blue?
It can be beautiful.
https://www.reddit.com/r/medlabprofessionals/comments/16lep3...
It's an easy way to blue yourself.
https://www.youtube.com/watch?v=9GYtgFdXCGE
it turns you red?
It turns you into a meth head.
This research was funded by multiple NIH grants, a Department of Defense grant, and the Martin Family Foundation.
How is this administered? Seems like a crucial detail to omit.
> This has the potential to become a rapid, intravenous antidote for carbon monoxide
So intravenously, presumably.
You can spread it on bread, melt it over pancakes, rub it all over corn on the cob, put it in baked potatoes, etc, promise!
not very on topic, but for those who missed one of the more surreal reddit threads in history:
- [MA] Post-it notes left in apartment [0]
- and the update from OP a while later [1]
[0]: https://www.reddit.com/r/legaladvice/comments/34l7vo/ma_post...
[1]: https://www.reddit.com/r/AskReddit/comments/49zfvb/what_is_t...
It looks like he found a note in his room and see some strange thing in the window, and someone somehow says it's CO but it may be that the OP has unrelated hallucinations. Is this a symptom of CO poisoning? I think you only get sleepy, faint and die.
CO exposure is accumulative. If you’re around an intense source of it you’re toast. But with a small point source or decent ventilation it kills you slower.
And your body produces new blood cells every day, so minor sources like wood smoke or burning a candle don’t dose you enough to be a problem, unless perhaps your day job is as an athlete.
Chronic exposure can lead to memory loss, yes. You're describing the symptoms of acute exposure.
>New Protein Therapy Shows Promise as Antidote for Carbon Monoxide Poisoning
So Shatner was right all along: not only is Promise Margarine good for lowering your cholesterol level, but it can also treat carbon monoxide poisoning! And it tastes like butter, promise.
https://www.youtube.com/watch?v=n3wf717fKFE
I don't see a relation of any kind and I hate commercials maybe more than anybody else, but it's always a good time for a funny one with Shatner :)
Sheez, I can't believe I have to explain that Shatner shows Promise as antidote for high cholesterol too.